PDB entry 1qg5

View 1qg5 on RCSB PDB site
Description: high resolution crystal structure of the bovine beta-lactoglobulin (isoform a)
Deposited on 1999-04-20, released 2001-04-21
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-21, with a file datestamp of 2001-04-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1qg5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qg5A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslvcq
    clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qg5A (A:)
    livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
    wendecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaeqslvcqcl
    vrtpevddealekfdkalkalpmhirlsfnpt