PDB entry 1qg2

View 1qg2 on RCSB PDB site
Description: canine GDP-ran r76e mutant
Class: gtpase
Keywords: gtpase, nuclear transport
Deposited on 1999-04-20, released 1999-06-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.174
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ran)
    Species: Canis lupus familiaris [TaxId:9615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62825
      • engineered (75)
    Domains in SCOPe 2.06: d1qg2a_
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qg2A (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfggledgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qg2A (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfggledgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqtta