PDB entry 1qg1

View 1qg1 on RCSB PDB site
Description: growth factor receptor binding protein sh2 domain complexed with an shc-derived peptide
Class: hormone/growth factor
Keywords: signal transduction, sh2 domain, phosphotyrosyl peptide, complex (signal transduction/peptide)
Deposited on 1999-04-19, released 1999-04-27
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein (growth factor receptor binding protein)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (2-103)
      • cloning artifact (0-1)
    Domains in SCOP 1.73: d1qg1e_
  • Chain 'I':
    Compound: protein (shc-derived peptide)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29353 (0-12)
      • modified residue (4)

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qg1E (E:)
    gshpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdga
    gkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqpt
    

  • Chain 'I':
    No sequence available.