PDB entry 1qg0

View 1qg0 on RCSB PDB site
Description: wild-type pea fnr
Class: oxidoreductase
Keywords: flavoenzyme, photosynthesis, electron transfer, hydride transfer, oxidoreductase
Deposited on 1999-04-18, released 1999-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin:nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qg0a1, d1qg0a2
  • Chain 'B':
    Compound: protein (ferredoxin:nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qg0b1, d1qg0b2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qg0A (A:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qg0A (A:)
    hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
    vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd
    lkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfngla
    wlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeel
    wellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qg0B (B:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qg0B (B:)
    hskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigi
    vpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcd
    lkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfngla
    wlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeel
    wellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevy