PDB entry 1qfz

View 1qfz on RCSB PDB site
Description: pea fnr y308s mutant in complex with nadph
Class: oxidoreductase
Keywords: flavoenzyme, photosynthesis, electron transfer, hydride transfer, oxidoreductase
Deposited on 1999-04-18, released 1999-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin:nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933
      • mutation (307)
    Domains in SCOPe 2.07: d1qfza1, d1qfza2
  • Chain 'B':
    Compound: protein (ferredoxin:nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933 (13-307)
      • mutation (307)
    Domains in SCOPe 2.07: d1qfzb1, d1qfzb2
  • Heterogens: SO4, FAD, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfzA (A:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfzB (B:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfzB (B:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
    kpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglaw
    lflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelw
    ellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevs