PDB entry 1qfy

View 1qfy on RCSB PDB site
Description: pea fnr y308s mutant in complex with nadp+
Class: oxidoreductase
Keywords: flavoenzyme, photosynthesis, electron transfer, hydride transfer, oxidoreductase
Deposited on 1999-04-18, released 1999-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.196
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin: nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933
      • mutation (307)
    Domains in SCOPe 2.06: d1qfya1, d1qfya2
  • Chain 'B':
    Compound: protein (ferredoxin: nadp+ reductase)
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10933 (Start-307)
      • mutation (307)
    Domains in SCOPe 2.06: d1qfyb1, d1qfyb2
  • Heterogens: SO4, FAD, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfyA (A:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfyB (B:)
    qvtteapakvvkhskkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfsteg
    evpyregqsigivpdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndage
    vvkgvcsnflcdlkpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmff
    ekhedyqfnglawlflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmy
    iqtrmaqyaeelwellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkka
    eqwnvevs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfyB (B:)
    skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
    pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
    kpgsevkitgpvgkemlmpkdpnatvimlgtgtgiapfrsflwkmffekhedyqfnglaw
    lflgvptsssllykeefekmkekapenfrldfavsreqvndkgekmyiqtrmaqyaeelw
    ellkkdntfvymcglkgmekgiddimvslaakdgidwieykrtlkkaeqwnvevs