PDB entry 1qfw

View 1qfw on RCSB PDB site
Description: ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti beta subunit
Class: immune system
Keywords: glycoprotein hormone, stimulation of production of progesterone, fvs specifically directed against alpha and beta subunit, immune system
Deposited on 1999-04-15, released 2000-04-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.26
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gonadotropin alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qfwa_
  • Chain 'B':
    Compound: gonadotrophin beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qfwb_
  • Chain 'H':
    Compound: antibody (anti alpha subunit) (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QFW (Start-116)
    Domains in SCOPe 2.05: d1qfwh_
  • Chain 'I':
    Compound: antibody (anti beta subunit) (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QFW (0-End)
    Domains in SCOPe 2.05: d1qfwi_
  • Chain 'L':
    Compound: antibody (anti alpha subunit) (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QFW (0-113)
    Domains in SCOPe 2.05: d1qfwl_
  • Chain 'M':
    Compound: antibody (anti beta subunit) (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QFW (0-107)
    Domains in SCOPe 2.05: d1qfwm_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfwA (A:)
    apdtqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestcc
    vaksynrvtvmggfkvenhtachcstcyyhks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwA (A:)
    dcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvaksy
    nrvtvmggfkvenhtachcstcyyhks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfwB (B:)
    skeplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyr
    dvrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcddprfqdsss
    skapppslpspsrlpgpsdtpilpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwB (B:)
    keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
    vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcdd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1qfwH (H:)
    qvqlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyy
    nekfkskatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwH (H:)
    qlqqsgaelvkpgasvklsckasdytftsywmhwvkqrpgqglewigeinptngrtyyne
    kkatltvaasastaamqassltsedsavyycarrygnsfdywgqgttvtvss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1qfwI (I:)
    qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
    pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwI (I:)
    qvqlqesgghlvkpggslklscaasgfafssfdmswirqtpekrlewvasitnvgtytyy
    pgsvkgrfsisrdnarntlnlqmsslrsedtalyfcarqgtaaqpywyfdvwgagttvtv
    s
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1qfwL (L:)
    dieltqspdslavslgqratiscrasesvdsygnsfmqwyqqkpgqppklliyrasnles
    giparfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfwL (L:)
    dieltqspdslavslgqratiscrasedsygnsfmqwyqqkpgqppklliyrasnlesgi
    parfsgtgsrtdftltinpveaddvatyycqqsdeypymytfgggtkleikr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfwM (M:)
    dieltqspksmsmsvgervtlsckasetvdsfvswyqqkpeqspkllifgasnrfsgvpd
    rftgsgsatdftltissvqaedfadyhcgqtynhpytfgggtkleikr