PDB entry 1qfu

View 1qfu on RCSB PDB site
Description: influenza virus hemagglutinin complexed with a neutralizing antibody
Class: Viral protein/Immune system
Keywords: COMPLEX (HEMAGGLUTININ-IMMMUNOGLOBULIN), HEMAGGLUTININ, IMMUNOGLOBULIN, Viral protein-Immune system COMPLEX
Deposited on 1999-04-14, released 1999-04-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hemagglutinin (ha1 chain))
    Species: Influenza A virus (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qfua_
  • Chain 'B':
    Compound: protein (hemagglutinin (ha2 chain))
    Species: Influenza A virus (A/X-31(H3N2)) [TaxId:132504]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qfub_
  • Chain 'H':
    Compound: protein (immunoglobulin igg1-kappa antibody (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QFU (0-222)
    Domains in SCOPe 2.03: d1qfuh1, d1qfuh2
  • Chain 'L':
    Compound: protein (immunoglobulin igg1-kappa antibody (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1QFU (0-216)
    Domains in SCOPe 2.03: d1qful1, d1qful2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfuA (A:)
    qdlpgndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrild
    gidctlidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlef
    itegftwtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiw
    gihhpstnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfuA (A:)
    statlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlid
    allgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwt
    gvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgihhpstn
    qeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfuB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqikg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfuB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktrrqlrenaeemgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqik
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfuH (H:)
    qvqlqqpgaelvrpgasvklsckasgytlttywmnwfkqrpdqglewigridpydsethy
    nqkfkdkailtvdrssstaymqlssltsedsavyyctrflqittiiygmdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfuL (L:)
    dvvmtqtplslpvslgdqasiscrssqtlvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqnthvpytfgggtkleikradaaptv
    sifppskiqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn