PDB entry 1qfr

View 1qfr on RCSB PDB site
Description: nmr solution structure of phosphocarrier protein hpr from enterococcus faecalis
Class: transport protein
Keywords: histidine containing phosphcarrier protein, enterococcus faecalis, nmr, protein, transport protein
Deposited on 1999-04-13, released 2001-02-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphocarrier protein HPr
    Species: Enterococcus faecalis [TaxId:1351]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07515 (0-87)
      • conflict (88)
    Domains in SCOPe 2.04: d1qfra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfrA (A:)
    mekkefhivaetgiharpatllvqtaskfnsdinleykgksvnlksimgvmslgvgqgsd
    vtitvdgadeaegmaaivetlqkeglaeq