PDB entry 1qfn

View 1qfn on RCSB PDB site
Description: glutaredoxin-1-ribonucleotide reductase b1 mixed disulfide bond
Deposited on 1999-04-12, released 2000-01-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-01-01, with a file datestamp of 1999-12-31.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.55: d1qfna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qfnA (A:)
  mqtvifgrsgcpysvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
  qifvdqqhiggytdfaawvkenlda