PDB entry 1qfn

View 1qfn on RCSB PDB site
Description: glutaredoxin-1-ribonucleotide reductase b1 mixed disulfide bond
Class: electron transport/oxidoreductase
Keywords: glutaredoxin, ribonucleotide reductase, disulfide, electron transfer, electron transport/oxidoreductase complex
Deposited on 1999-04-12, released 2000-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutaredoxin 1)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68688 (0-84)
      • engineered (13)
    Domains in SCOPe 2.08: d1qfna_
  • Chain 'B':
    Compound: protein (ribonucleoside-diphosphate reductase 1)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfnA (A:)
    mqtvifgrsgcpysvrakdlaeklsnerddfqyqyvdiraegitkedlqqkagkpvetvp
    qifvdqqhiggytdfaawvkenlda
    

  • Chain 'B':
    No sequence available.