PDB entry 1qfm

View 1qfm on RCSB PDB site
Description: prolyl oligopeptidase from porcine muscle
Class: hydrolase
Keywords: prolyl oligopeptidase, amnesia, alpha/beta-hydrolase, beta-propeller, hydrolase
Deposited on 1999-04-12, released 1999-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.19
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (prolyl oligopeptidase)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23687 (0-709)
      • see remark 999 (24)
      • see remark 999 (56)
      • see remark 999 (254)
      • see remark 999 (174)
      • see remark 999 (600)
    Domains in SCOPe 2.07: d1qfma1, d1qfma2
  • Heterogens: SGL, SGM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfmA (A:)
    mlsfqypdvyrdetaiqdyhghkvcdpyawledpdseqtkafveaqnkitvpfleqcpir
    glykermtelydypkyschfkkgkryfyfyntglqnqrvlyvqdslegearvfldpnils
    ddgtvalrgyafsedgeyfayglsasgsdwvtikfmkvdgakelpdvlervkfscmawth
    dgkgmfynaypqqdgksdgtetstnlhqklyyhvlgtdqsedilcaefpdepkwmggael
    sddgryvllsiregcdpvnrlwycdlqqesngitgilkwvklidnfegeydyvtnegtvf
    tfktnrhspnyrlinidftdpeeskwkvlvpehekdvlewvacvrsnflvlcylhdvknt
    lqlhdlatgallkifplevgsvvgysgqkkdteifyqftsflspgiiyhcdltkeelepr
    vfrevtvkgidasdyqtvqifypskdgtkipmfivhkkgikldgshpaflygyggfnisi
    tpnysvsrlifvrhmggvlavanirgggeygetwhkggilankqncfddfqcaaeylike
    gytspkrltinggsnggllvatcanqrpdlfgcviaqvgvmdmlkfhkytighawttdyg
    csdskqhfewlikysplhnvklpeaddiqypsmllltadhddrvvplhslkfiatlqyiv
    grsrkqnnpllihvdtkaghgagkptakvieevsdmfafiarclnidwip