PDB entry 1qfh

View 1qfh on RCSB PDB site
Description: dimerization of gelation factor from dictyostelium discoideum: crystal structure of rod domains 5 and 6
Class: actin binding protein
Keywords: actin binding protein, immunoglobulin, gelation factor, abp-120
Deposited on 1999-04-11, released 1999-04-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (gelation factor)
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qfha1, d1qfha2
  • Chain 'B':
    Compound: protein (gelation factor)
    Species: Dictyostelium discoideum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qfhb1, d1qfhb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfhA (A:)
    kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda
    kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkciegangedssfgsftftv
    aaknkkgevktyggdkfevsitgpaeeitldaidnqdgtytaayslvgngrfstgvklng
    khiegspfkqvlgnpgkknpevksftttrtan
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qfhB (B:)
    kpapsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvda
    kvtdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkciegangedssfgsftftv
    aaknkkgevktyggdkfevsitgpaeeitldaidnqdgtytaayslvgngrfstgvklng
    khiegspfkqvlgnpgkknpevksftttrtan