PDB entry 1qfg

View 1qfg on RCSB PDB site
Description: e. coli ferric hydroxamate receptor (fhua)
Class: metal transport
Keywords: tonb-dependent receptor, integral outer membrane protein, ferrichrome-iron receptor, active transport, iron transport protein, lipopolysaccharide, metal transport
Deposited on 1999-04-10, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferric hydroxamate uptake receptor)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06971 (Start-724)
      • intrachain his tag (405-415)
    Domains in SCOPe 2.08: d1qfga_
  • Heterogens: NI, PO4, FTT, DAO, MYR, DDQ, DPO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfgA (A:)
    avepkedtitvtaapapqesawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemal
    hqpksvkealsytpgvsvgtrgasntydhliirgfaaegqsqnnylnglklqgnfyndav
    idpymleraeimrgpvsvlygksspggllnmvskrptteplkevqfkagtdslfqtgfdf
    sdsldddgvysyrltglarsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepe
    tgyygwlpkegtveplpngkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnl
    rfaenktsqnsvygygvcsdpanayskqcaalapadkghylarkyvvddeklqnfsvdtq
    lqskfatgdidhtlltgvdfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntd
    fdfnakdpansgpyrilnkqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttd
    krddkqftwrggvnylfdngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvp
    edrpivvtgavynltktnnlmadpegsffsveggeirargveieakaalsasvnvvgsyt
    ytdaeyttdttykgntpaqvpkhmaslwadytffdgplsgltlgtggrytgssygdpans
    fkvgsytvvdalvrydlarvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvat
    atfrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfgA (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
    kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
    ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
    nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
    qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
    rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf