PDB entry 1qff

View 1qff on RCSB PDB site
Description: e. coli ferric hydroxamate uptake receptor (fhua) in complex with bound ferrichrome-iron
Deposited on 1999-04-10, released 2000-07-26
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-26, with a file datestamp of .
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qffa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qffA (A:)
    esawgpaatiaarqsatgtktdtpiqkvpqsisvvtaeemalhqpksvkealsytpgvsv
    gtrgasntydhliirgfaaegqsqnnylnglklqgnfyndavidpymleraeimrgpvsv
    lygksspggllnmvskrptteplkevqfkagtdslfqtgfdfsdsldddgvysyrltgla
    rsanaqqkgseeqryaiapaftwrpddktnftflsyfqnepetgyygwlpkegtveplpn
    gkrlptdfnegaknntysrnekmvgysfdhefndtftvrqnlrfaenktsqnsvygygvc
    sdpanayskqcaalapadkghylarkyvvddeklqnfsvdtqlqskfatgdidhtlltgv
    dfmrmrndinawfgyddsvpllnlynpsshhhhhhgssvntdfdfnakdpansgpyriln
    kqkqtgvyvqdqaqwdkvlvtlggrydwadqeslnrvagttdkrddkqftwrggvnylfd
    ngvtpyfsysesfepssqvgkdgnifapskgkqyevgvkyvpedrpivvtgavynltktn
    nlmadpegsffsveggeirargveieakaalsasvnvvgsytytdaeyttdttykgntpa
    qvpkhmaslwadytffdgplsgltlgtggrytgssygdpansfkvgsytvvdalvrydla
    rvgmagsnvalhvnnlfdreyvascfntygcfwgaerqvvatatfrf