PDB entry 1qfc

View 1qfc on RCSB PDB site
Description: structure of rat purple acid phosphatase
Deposited on 1999-04-08, released 2000-04-10
The last revision prior to the SCOP 1.59 freeze date was dated 2000-04-10, with a file datestamp of 2000-04-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1qfca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfcA (A:)
    tapastlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvh
    dandkrfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrl
    rfkvprsnitvaifmldtvmlcgnsddfvsqqpemprdlgvartqlswlkkqlaaakedy
    vlvaghypiwsiaehgptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsg
    agnfmdpsvrhqrkvpngylrfhygsedslggftyveigskemsityveasgkslfktsl
    pr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfcA (A:)
    tapastlrfvavgdwggvpnapfhtaremanakeiartvqimgadfimslgdnfyftgvh
    dandkrfqetfedvfsdralrnipwyvlagnhdhlgnvsaqiayskiskrwnfpspyyrl
    rfkvprsnitvaifmldtvmlcgnsvartqlswlkkqlaaakedyvlvaghypiwsiaeh
    gptrclvknlrpllaaygvtaylcghdhnlqylqdengvgyvlsgagnfmdpsvrhqrkv
    pngylrfhygsedslggftyveigskemsityveasgkslfktslpr