PDB entry 1qf6

View 1qf6 on RCSB PDB site
Description: structure of e. coli threonyl-tRNA synthetase complexed with its cognate tRNA
Class: ligase/RNA
Keywords: threonyl-tRNA synthetase, tRNA(thr), amp, mRNA, aminoacylation, translational regulation, protein/RNA, ligase-RNA complex
Deposited on 1999-04-06, released 1999-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: threonyl-tRNA synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1qf6a1, d1qf6a2, d1qf6a3, d1qf6a4
  • Chain 'B':
    Compound: threonine tRNA
    Species: Escherichia coli [TaxId:562]
  • Heterogens: ZN, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qf6A (A:)
    mpvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsii
    takdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveal
    ekrmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvd
    mcrgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaa
    krdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmd
    rvlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgs
    chrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkl
    strpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqc
    gtvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapv
    qvvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdke
    vesgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qf6A (A:)
    pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
    akdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveale
    krmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdm
    crgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee
    

  • Chain 'B':
    No sequence available.