PDB entry 1qf6

View 1qf6 on RCSB PDB site
Description: structure of e. coli threonyl-trna synthetase complexed with its cognate trna
Deposited on 1999-04-06, released 1999-05-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-19, with a file datestamp of 2000-06-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qf6A (A:)
    pvitlpdgsqrhydhavspmdvaldigpglakaciagrvngelvdacdliendaqlsiit
    akdeegleiirhscahllghaikqlwphtkmaigpvidngfyydvdldrtltqedveale
    krmhelaeknydvikkkvswhearetfanrgesykvsildeniahddkpglyfheeyvdm
    crgphvpnmrfchhfklmktagaywrgdsnnkmlqriygtawadkkalnaylqrleeaak
    rdhrkigkqldlyhmqeeapgmvfwhndgwtifrelevfvrsklkeyqyqevkgpfmmdr
    vlwektghwdnykdamfttssenreycikpmncpghvqifnqglksyrdlplrmaefgsc
    hrnepsgslhglmrvrgftqddahifcteeqirdevngcirlvydmystfgfekivvkls
    trpekrigsdemwdraeadlavaleennipfeyqlgegafygpkieftlydcldrawqcg
    tvqldfslpsrlsasyvgednerkvpvmihrailgsmerfigilteefagffptwlapvq
    vvimnitdsqseyvneltqklsnagirvkadlrnekigfkirehtlrrvpymlvcgdkev
    esgkvavrtrrgkdlgsmdvnevieklqqeirsrslkqlee