PDB entry 1qf4

View 1qf4 on RCSB PDB site
Description: design, synthesis, and x-ray crystal structure of an enzyme bound bisubstrate hybrid inhibitor of adenylosuccinate synthetase
Deposited on 1999-04-06, released 1999-12-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-02, with a file datestamp of 1999-12-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.194
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qf4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qf4A (A:)
    gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
    renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
    rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
    vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
    snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
    tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
    aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
    etmilrdpfda