PDB entry 1qf3

View 1qf3 on RCSB PDB site
Description: peanut lectin complexed with methyl-beta-galactose
Deposited on 1999-04-06, released 1999-07-27
The last revision prior to the SCOP 1.67 freeze date was dated 2001-09-26, with a file datestamp of 2001-09-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.195
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qf3a_
  • Chain 'B':
    Domains in SCOP 1.67: d1qf3b_
  • Chain 'C':
    Domains in SCOP 1.67: d1qf3c_
  • Chain 'D':
    Domains in SCOP 1.67: d1qf3d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qf3A (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qf3A (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qf3B (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qf3B (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qf3C (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qf3C (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qf3D (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qf3D (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt