PDB entry 1qez

View 1qez on RCSB PDB site
Description: sulfolobus acidocaldarius inorganic pyrophosphatase: an archael pyrophosphatase.
Class: hydrolase
Keywords: inorganic pyrophosphatase, thermostability, magnesium, hydrolase
Deposited on 1999-04-06, released 1999-04-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.197
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (inorganic pyrophosphatase)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qeza_
  • Chain 'B':
    Compound: protein (inorganic pyrophosphatase)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qezb_
  • Chain 'C':
    Compound: protein (inorganic pyrophosphatase)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qezc_
  • Chain 'D':
    Compound: protein (inorganic pyrophosphatase)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qezd_
  • Chain 'E':
    Compound: protein (inorganic pyrophosphatase)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qeze_
  • Chain 'F':
    Compound: protein (inorganic pyrophosphatase)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qezf_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qezA (A:)
    mklspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtle
    edgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdi
    ndlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qezA (A:)
    klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
    dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
    dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qezB (B:)
    mklspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtle
    edgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdi
    ndlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qezB (B:)
    klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
    dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
    dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qezC (C:)
    mklspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtle
    edgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdi
    ndlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qezC (C:)
    klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
    dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
    dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qezD (D:)
    mklspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtle
    edgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdi
    ndlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qezD (D:)
    klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
    dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
    dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qezE (E:)
    mklspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtle
    edgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdi
    ndlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qezE (E:)
    klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
    dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
    dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1qezF (F:)
    mklspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtle
    edgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdi
    ndlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsggq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qezF (F:)
    klspgknapdvvnvlveipqgsnikyeyddeegvikvdrvlytsmnypfnygfipgtlee
    dgdpldvlvitnyqlypgsvievrpigilymkdeegedakivavpkdktdpsfsnikdin
    dlpqatknkivhffehykelepgkyvkisgwgsateaknriqlaikrvsg