PDB entry 1qey

View 1qey on RCSB PDB site
Description: NMR Structure Determination of the Tetramerization Domain of the MNT Repressor: An Asymmetric A-Helical Assembly in Slow Exchange
Class: gene regulation
Keywords: oligomerization, transcriptional control, p22 mnt repressor, gene regulation
Deposited on 1999-04-03, released 1999-08-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (regulatory protein mnt)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qeya_
  • Chain 'B':
    Compound: protein (regulatory protein mnt)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qeyb_
  • Chain 'C':
    Compound: protein (regulatory protein mnt)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qeyc_
  • Chain 'D':
    Compound: protein (regulatory protein mnt)
    Species: Enterobacteria phage P22 [TaxId:10754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qeyd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qeyA (A:)
rndaerladeqselvkkmvfdtlkdlykktt

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qeyB (B:)
rndaerladeqselvkkmvfdtlkdlykktt

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qeyC (C:)
rndaerladeqselvkkmvfdtlkdlykktt

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qeyD (D:)
rndaerladeqselvkkmvfdtlkdlykktt