PDB entry 1qex

View 1qex on RCSB PDB site
Description: bacteriophage t4 gene product 9 (gp9), the trigger of tail contraction and the long tail fibers connector
Class: Viral protein
Keywords: BACTERIOPHAGE T4, BASEPLATE, GENE PRODUCT 9, OLIGOMERIZATION, Viral protein
Deposited on 1999-03-30, released 1999-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.239
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bacteriophage t4 gene product 9 (gp9))
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qexa_
  • Chain 'B':
    Compound: protein (bacteriophage t4 gene product 9 (gp9))
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: 9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qexb_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qexA (A:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qexB (B:)
    mfiqepkklidtgeignastgdilfdggnkinsdfnaiynafgdqrkmavangtgadgqi
    ihatgyyqkhsiteyatpvkvgtrhdidtstvgvkviiergelgdcvefinsngsisvtn
    pltiqaidsikgvsgnlvvtspyskvtlrcissdnstsvwnysiesmfgqkespaegtwn
    istsgsvdiplfhrteynmakllvtcqsvdgrkiktaeinilvdtvnsevisseyavmrv
    gneteedeianiafsikenyvtatissstvgmraavkviatqkigvaq