PDB entry 1qe3

View 1qe3 on RCSB PDB site
Description: pnb esterase
Deposited on 1999-07-12, released 1999-07-21
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-29, with a file datestamp of 2000-03-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.22
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qe3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qe3A (A:)
    thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpic
    pqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgs
    klaaqgevivvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdpd
    nvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgine
    sqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgip
    lligttrdegylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtdl
    lfwrpavayasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakaei
    tdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekrq
    klf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qe3A (A:)
    thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpic
    pqpslprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgsklaaqgevi
    vvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdpdnvtvfgesa
    ggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlginesqldrlhtv
    aaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgiplligttrde
    gylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtdllfwrpavay
    asaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglitdevkqlshtiqsawi
    tfaktgnpsteavnwpayheetretvildseitiendpesekrqklf