PDB entry 1qe3

View 1qe3 on RCSB PDB site
Description: pnb esterase
Class: hydrolase
Keywords: alpha-beta hydrolase directed evolution
Deposited on 1999-07-12, released 1999-07-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.22
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: para-nitrobenzyl esterase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qe3a_
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qe3A (A:)
    mthqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpi
    cpqpsdllslsytelprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydg
    sklaaqgevivvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdp
    dnvtvfgesaggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlgin
    esqldrlhtvaaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgi
    plligttrdegylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtd
    llfwrpavayasaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglermakae
    itdevkqlshtiqsawitfaktgnpsteavnwpayheetretvildseitiendpesekr
    qklfpskge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qe3A (A:)
    thqivttqygkvkgttengvhkwkgipyakppvgqwrfkapeppevwedvldataygpic
    pqpslprqsedclyvnvfapdtpsqnlpvmvwihggafylgagseplydgsklaaqgevi
    vvtlnyrlgpfgflhlssfdeaysdnlglldqaaalkwvrenisafggdpdnvtvfgesa
    ggmsiaallampaakglfqkaimesgasrtmtkeqaastaaaflqvlginesqldrlhtv
    aaedllkaadqlriaekenifqlffqpaldpktlpeepeksiaegaasgiplligttrde
    gylfftpdsdvhsqetldaaleyllgkplaekaadlyprslesqihmmtdllfwrpavay
    asaqshyapvwmyrfdwhpekppynkafhalelpfvfgnldglitdevkqlshtiqsawi
    tfaktgnpsteavnwpayheetretvildseitiendpesekrqklf