PDB entry 1qdx

View 1qdx on RCSB PDB site
Description: crystal structure of v61h mutant of cytochrome b5
Class: oxidoreductase
Keywords: protein mutant
Deposited on 1999-07-11, released 2000-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-11-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00171 (0-81)
      • engineered (58)
    Domains in SCOPe 2.07: d1qdxa_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qdxA (A:)
    avkyytleeiqkhnnskstwlilhykvydltkfleehpggeevlreqaggdatenfedhg
    hstdarelsktfiigelhpddr