PDB entry 1qdt

View 1qdt on RCSB PDB site
Description: 2.1 a resolution structure of escherichia coli lytic transglycoyslase slt35 in complex with calcium
Class: hydrolase
Keywords: alpha-helical protein with an five-stranded antiparallel beta-sheet, glycosyl transferase, ef-hand, hydrolase
Deposited on 1999-07-10, released 2000-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.159
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lytic murein transglycosylase b
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41052 (0-321)
      • engineered (0-1)
    Domains in SCOPe 2.07: d1qdta_
  • Heterogens: CA, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qdtA (A:)
    mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqa
    pttsvkppsgpngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgii
    gvetrwgrvmgktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfag
    amgygqfmpssykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqa
    pglpngfktkysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitryn
    hsthyamavwqlgqavalarvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdtA (A:)
    mvepqhnvmqmggdfannpnaqqfidkmvnkhgfdrqqlqeilsqakrldsvlrlmdnqg
    pngawlryrkkfitpdnvqngvvfwnqyedalnrawqvygvppeiivgiigvetrwgrvm
    gktrildalatlsfnyprraeyfsgeletfllmardeqddplnlkgsfagamgygqfmps
    sykqyavdfsgdghinlwdpvdaigsvanyfkahgwvkgdqvavmangqapglpngfktk
    ysisqlaaagltpqqplgnhqqasllrldvgtgyqywyglpnfytitrynhsthyamavw
    qlgqavalarvq