PDB entry 1qdn

View 1qdn on RCSB PDB site
Description: amino terminal domain of the n-ethylmaleimide sensitive fusion protein (nsf)
Class: fusion protein
Keywords: double-psi beta barrel alpha/beta barrel, vesicular-fusion protein
Deposited on 1999-05-21, released 1999-06-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (n-ethylmaleimide sensitive fusion protein (nsf))
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qdna1, d1qdna2
  • Chain 'B':
    Compound: protein (n-ethylmaleimide sensitive fusion protein (nsf))
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qdnb1, d1qdnb2
  • Chain 'C':
    Compound: protein (n-ethylmaleimide sensitive fusion protein (nsf))
    Species: Cricetulus griseus [TaxId:10029]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1qdnc1, d1qdnc2
  • Heterogens: SO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qdnA (A:)
    tmagrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgs
    vafslpqrkwaglsigqeievalysfdkakqcigtmtieidflqkknidsnpydtdkmaa
    efiqqfnnqafsvgqqlvfsfndklfgllvkdieamdpsilkgepasgkrqkievglvvg
    nsqvafekaensslnligkaktke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdnA (A:)
    magrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgsv
    afslpqrkwaglsigqeievalysfdkakqcigtmtieidflqkknidsnpydtdkmaae
    fiqqfnnqafsvgqqlvfsfndklfgllvkdieamdpqkievglvvgnsqvafekaenss
    lnligkakt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qdnB (B:)
    tmagrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgs
    vafslpqrkwaglsigqeievalysfdkakqcigtmtieidflqkknidsnpydtdkmaa
    efiqqfnnqafsvgqqlvfsfndklfgllvkdieamdpsilkgepasgkrqkievglvvg
    nsqvafekaensslnligkaktke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdnB (B:)
    magrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgsv
    afslpqrkwaglsigqeievalysfdkakqcigtmtieidflqkknidsnpydtdkmaae
    fiqqfnnqafsvgqqlvfsfndklfgllvkdieamdpqkievglvvgnsqvafekaenss
    lnligkakt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qdnC (C:)
    tmagrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgs
    vafslpqrkwaglsigqeievalysfdkakqcigtmtieidflqkknidsnpydtdkmaa
    efiqqfnnqafsvgqqlvfsfndklfgllvkdieamdpsilkgepasgkrqkievglvvg
    nsqvafekaensslnligkaktke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdnC (C:)
    tmagrsmqaarcptdelslsncavvsekdyqsgqhvivrtspnhkyiftlrthpsvvpgs
    vafslpqrkwaglsigqeievalysfdkakqcigtmtieidflqkknidsnpydtdkmaa
    efiqqfnnqafsvgqqlvfsfndklfgllvkdieamdpqkievglvvgnsqvafekaens
    slnligkakt