PDB entry 1qdm

View 1qdm on RCSB PDB site
Description: crystal structure of prophytepsin, a zymogen of a barley vacuolar aspartic proteinase.
Class: hydrolase
Keywords: aspartic proteinases, phytepsin, saposin-like domain, zymogen structure, hydrolase
Deposited on 1999-05-19, released 1999-07-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prophytepsin
    Species: Hordeum vulgare [TaxId:4513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qdma1, d1qdma2
  • Chain 'B':
    Compound: prophytepsin
    Species: Hordeum vulgare [TaxId:4513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qdmb1, d1qdmb2
  • Chain 'C':
    Compound: prophytepsin
    Species: Hordeum vulgare [TaxId:4513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1qdmc1, d1qdmc2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qdmA (A:)
    vrialkkrpidrnsrvatglsggeeqpllsganplrseeegdivalknymnaqyfgeigv
    gtppqkftvifdtgssnlwvpsakcyfsiacylhsrykagasstykkngkpaaiqygtgs
    iagyfsedsvtvgdlvvkdqefieatkepgitflvakfdgilglgfkeisvgkavpvwyk
    mieqglvsdpvfsfwlnrhvdegeggeiifggmdpkhyvgehtyvpvtqkgywqfdmgdv
    lvggkstgfcaggcaaiadsgtsllagptaiiteinekigaagvvsqecktivsqygqqi
    ldlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvksnglradpmcsacemavv
    wmqnqlaqnktqdlildyvnqlcnrlpspmgesavdcgslgsmpdieftiggkkfalkpe
    eyilkvgegaaaqcisgftamdippprgplwilgdvfmgpyhtvfdygklrigfakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdmA (A:)
    vrialkkrpidrnsrvatglsgeeegdivalknymnaqyfgeigvgtppqkftvifdtgs
    snlwvpsakcyfsiacylhsrykagasstykkngkpaaiqygtgsiagyfsedsvtvgdl
    vvkdqefieatkepgitflvakfdgilglgfkeisvgkavpvwykmieqglvsdpvfsfw
    lnrhvggeiifggmdpkhyvgehtyvpvtqkgywqfdmgdvlvggkstgfcaggcaaiad
    sgtsllagptaiiteinekigaagvvsqecktivsqygqqildlllaetqpkkicsqvgl
    ctadpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlpspmgesavdcgslgsmpd
    ieftiggkkfalkpeeyilkvgegaaaqcisgftamdippprgplwilgdvfmgpyhtvf
    dygklrigfakaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qdmB (B:)
    vrialkkrpidrnsrvatglsggeeqpllsganplrseeegdivalknymnaqyfgeigv
    gtppqkftvifdtgssnlwvpsakcyfsiacylhsrykagasstykkngkpaaiqygtgs
    iagyfsedsvtvgdlvvkdqefieatkepgitflvakfdgilglgfkeisvgkavpvwyk
    mieqglvsdpvfsfwlnrhvdegeggeiifggmdpkhyvgehtyvpvtqkgywqfdmgdv
    lvggkstgfcaggcaaiadsgtsllagptaiiteinekigaagvvsqecktivsqygqqi
    ldlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvksnglradpmcsacemavv
    wmqnqlaqnktqdlildyvnqlcnrlpspmgesavdcgslgsmpdieftiggkkfalkpe
    eyilkvgegaaaqcisgftamdippprgplwilgdvfmgpyhtvfdygklrigfakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdmB (B:)
    vrialkkrpidrnsrvatglsgeeegdivalknymnaqyfgeigvgtppqkftvifdtgs
    snlwvpsakcyfsiacylhsrykagasstykkngkpaaiqygtgsiagyfsedsvtvgdl
    vvkdqefieatkepgitflvakfdgilglgfkeisvgkavpvwykmieqglvsdpvfsfw
    lnrhvggeiifggmdpkhyvgehtyvpvtqkgywqfdmgdvlvggkstgfcaggcaaiad
    sgtsllagptaiiteinekigaagvvsqecktivsqygqqildlllaetqpkkicsqvgl
    ctadpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlpspmgesavdcgslgsmpd
    ieftiggkkfalkpeeyilkvgegaaaqcisgftamdippprgplwilgdvfmgpyhtvf
    dygklrigfakaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qdmC (C:)
    vrialkkrpidrnsrvatglsggeeqpllsganplrseeegdivalknymnaqyfgeigv
    gtppqkftvifdtgssnlwvpsakcyfsiacylhsrykagasstykkngkpaaiqygtgs
    iagyfsedsvtvgdlvvkdqefieatkepgitflvakfdgilglgfkeisvgkavpvwyk
    mieqglvsdpvfsfwlnrhvdegeggeiifggmdpkhyvgehtyvpvtqkgywqfdmgdv
    lvggkstgfcaggcaaiadsgtsllagptaiiteinekigaagvvsqecktivsqygqqi
    ldlllaetqpkkicsqvglctfdgtrgvsagirsvvddepvksnglradpmcsacemavv
    wmqnqlaqnktqdlildyvnqlcnrlpspmgesavdcgslgsmpdieftiggkkfalkpe
    eyilkvgegaaaqcisgftamdippprgplwilgdvfmgpyhtvfdygklrigfakaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qdmC (C:)
    vrialkkrpidrnsrvatglsgeegdivalknymnaqyfgeigvgtppqkftvifdtgss
    nlwvpsakcyfsiacylhsrykagasstykkngkpaaiqygtgsiagyfsedsvtvgdlv
    vkdqefieatkepgitflvakfdgilglgfkeisvgkavpvwykmieqglvsdpvfsfwl
    nrhvggeiifggmdpkhyvgehtyvpvtqkgywqfdmgdvlvggkstgfcaggcaaiads
    gtsllagptaiiteinekigaagvvsqecktivsqygqqildlllaetqpkkicsqvglc
    tadpmcsacemavvwmqnqlaqnktqdlildyvnqlcnrlpspmgesavdcgslgsmpdi
    eftiggkkfalkpeeyilkvgegaaqcisgftamdippprgplwilgdvfmgpyhtvfdy
    gklrigfakaa