PDB entry 1qdd

View 1qdd on RCSB PDB site
Description: crystal structure of human lithostathine to 1.3 a resolution
Class: metal binding protein
Keywords: Pancreatic Stone Inhibitor, Lithostathine, METAL BINDING PROTEIN
Deposited on 1999-05-20, released 1999-05-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.132
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lithostathine
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05451 (0-143)
    • engineered (87)
  Domains in SCOPe 2.01: d1qdda_
• Heterogens: SIA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qddA (A:)
  qeaqtelpqariscpegtnayrsycyyfnedretwvdadlycqnmnsgnlvsvltqaega
  fvaslikesgtddfnvwiglhdpkknrawhwssgslvsykswgigapssvnpgycvslts
  stgfqkwkdvpcedkfsfvckfkn