PDB entry 1qcz

View 1qcz on RCSB PDB site
Description: crystal structure of e. coli pure, an unusual mutase that catalyzes the conversion of n5-carboxyaminoimidazole ribonucleotide (n5-cair) to 4-carboxyaminoimidazole ribonucleotide (cair) in the purine biosynthetic pathway
Class: lyase
Keywords: three-layer (alpha-beta-alpha) sandwich
Deposited on 1999-05-10, released 1999-11-10
The last revision prior to the SCOP 1.73 freeze date was dated 2000-06-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.186
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09028 (Start-168)
      • modified residue (13)
      • modified residue (22)
      • modified residue (78)
      • modified residue (109)
    Domains in SCOP 1.73: d1qcza_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1qczA (A:)
mssrnnparvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaee
ngyqviiagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtla
igkagaanaallaaqilathdkelhqrlndwrkaqtdevlenpdprgaa

    Sequence, based on observed residues (ATOM records): (download) 
    >1qczA (A:)
parvaivmgsksdwatmqfaaeifeilnvphhvevvsahrtpdklfsfaesaeengyqvi
iagaggaahlpgmiaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkaga
anaallaaqilathdkelhqrlndwrkaqtdevlenpdprgaa