PDB entry 1qcy

View 1qcy on RCSB PDB site
Description: the crystal structure of the i-domain of human integrin alpha1beta1
Deposited on 1999-05-12, released 2003-09-02
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-02, with a file datestamp of 2003-09-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1qcya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qcyA (A:)
tqldivivldgsnsiypwdsvtaflndllkrmdigpkqtqvgivqygenvthefnlnkys
steevlvaakkivqrggaqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnh
rlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdelal
vtivktlgerifa