PDB entry 1qcw

View 1qcw on RCSB PDB site
Description: flavocytochrome b2, arg289lys mutant
Deposited on 1999-05-07, released 1999-05-24
The last revision prior to the SCOP 1.63 freeze date was dated 2001-04-21, with a file datestamp of 2001-04-21.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1qcwa_
  • Chain 'B':
    Domains in SCOP 1.63: d1qcwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qcwA (A:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqkekdmklkfsntkagfkamkktnveesqgasralskfidpsltwkdieelkkk
    tklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlk
    dklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiems
    mrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcwA (A:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqkekdmklkfskfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvs
    gvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclga
    kgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkar
    tvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qcwB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqkekdmklkfsntkagfkamkktnveesqgasralskfidpsltwkdieelkkk
    tklpivikgvqrtedvikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlk
    dklevfvdggvrrgtdvlkalclgakgvglgrpflyanscygrngvekaieilrdeiems
    mrllgvtsiaelkpdlldlstlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcwB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatalcklgnplegekdvargcgqgvt
    kvpqmistlascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqkekdmklkfskfidpsltwkdieelkkktklpivikgvqrtedvikaaeigvs
    gvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalclga
    kgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlkar
    tvgvpndvlynevyegptltefeda