PDB entry 1qcq

View 1qcq on RCSB PDB site
Description: ubiquitin conjugating enzyme
Deposited on 1999-05-10, released 1999-05-17
The last revision prior to the SCOP 1.55 freeze date was dated 2000-03-06, with a file datestamp of 2000-03-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.24
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1qcqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1qcqA (A:)
mssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfptd
ypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpddpl
vpeiahiyktdrpkyeatarewtkkyav