PDB entry 1qcg

View 1qcg on RCSB PDB site
Description: low temperature structure of pokeweed antiviral protein
Class: antiviral protein
Keywords: pokeweed antiviral protein, ribosome inactivating protein, RNA substrate analogs
Deposited on 1999-05-04, released 1999-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.191
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pokeweed antiviral protein
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qcga_
  • Chain 'B':
    Compound: pokeweed antiviral protein
    Species: Phytolacca americana [TaxId:3527]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1qcgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcgA (A:)
    vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
    titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
    sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
    kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
    rvdeikpdvallnyvggscqtt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcgB (B:)
    vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
    titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
    sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
    kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
    rvdeikpdvallnyvggscqtt