PDB entry 1qcf

View 1qcf on RCSB PDB site
Description: crystal structure of hck in complex with a src family-selective tyrosine kinase inhibitor
Class: tyrosine kinase
Keywords: tyrosine kinase-inhibitor complex, down-regulated kinase, ordered activation loop
Deposited on 1999-05-04, released 1999-06-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: haematopoetic cell kinase (hck)
    Species: Homo sapiens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1qcfa1, d1qcfa2, d1qcfa3
  • Heterogens: PP1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qcfA (A:)
    gamgsgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsny
    varvdsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqg
    dtvkhykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwek
    daweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktl
    qhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafi
    eqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfg
    sftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmr
    cwknrpeerptfeyiqsvlddfytatesqyeeip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcfA (A:)
    sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
    dsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvk
    hykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdawe
    ipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktlqhdk
    lvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrn
    yihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfgsfti
    ksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwkn
    rpeerptfeyiqsvlddfytatesqyeeip