PDB entry 1qcf

View 1qcf on RCSB PDB site
Description:
Deposited on 1999-05-04, released 1999-06-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-06-08, with a file datestamp of 1999-06-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcfA (A:)
    sgiriivvalydyeaihhedlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarv
    dsleteewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvk
    hykirtldnggfyisprstfstlqelvdhykkgndglcqklsvpcmsskpqkpwekdawe
    ipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflaeanvmktlqhdk
    lvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqiaegmafieqrn
    yihrdlraanilvsaslvckiadfglarviedneytaregakfpikwtapeainfgsfti
    ksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpeelynimmrcwkn
    rpeerptfeyiqsvlddfytatesqyeeip