PDB entry 1qcb

View 1qcb on RCSB PDB site
Description: escherichia coli heat labile enterotoxin type iib b-pentamer
Deposited on 1999-04-30, released 2003-06-10
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'D':
    Domains in SCOP 1.65: d1qcbd_
  • Chain 'E':
    Domains in SCOP 1.65: d1qcbe_
  • Chain 'F':
    Domains in SCOP 1.65: d1qcbf_
  • Chain 'G':
    Domains in SCOP 1.65: d1qcbg_
  • Chain 'H':
    Domains in SCOP 1.65: d1qcbh_

PDB Chain Sequences:

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcbD (D:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcbE (E:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcbF (F:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcbG (G:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qcbH (H:)
    gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm
    taemrkiamaavlsgmrvnmcaspasspnviwaieleae