PDB entry 1qca

View 1qca on RCSB PDB site
Description: quadruple mutant q92c, n146f, y168f, i172v type III cat complexed with fusidic acid. crystals grown at ph 6.3. x-ray data collected at room temperature
Class: transferase (acyltransferase)
Keywords: chloramphenicol, fusidate, steroid, transferase (acyltransferase)
Deposited on 1995-08-03, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type III chloramphenicol acetyltransferase
    Species: Shigella flexneri [TaxId:623]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00484 (0-212)
      • conflict (85)
      • conflict (139)
      • conflict (161)
      • conflict (165)
    Domains in SCOPe 2.07: d1qcaa_
  • Heterogens: CO, FUA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qcaA (A:)
    mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
    avnqfdelrmaikddelivwdsvdpcftvfhqetetfsalscpyssdidqfmvnylsvme
    ryksdtklfpqgvtpenhlfisalpwvnfdsfnlnvanftdffapvitmakyqqegdrll
    lplsvqvhhavcdgfhvarfinrlqelcnsklk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qcaA (A:)
    mnytkfdvknwvrrehfefyrhrlpcgfsltskidittlkkslddsaykfypvmiyliaq
    avnqfdelrmaikddelivwdsvdpcftvfhqetetfsalscpyssdidqfmvnylsvme
    ryksdtklfpqgpenhlfisalpwvnfdsfnlnvanftdffapvitmakyqqegdrlllp
    lsvqvhhavcdgfhvarfinrlqelcnsklk