PDB entry 1qc5

View 1qc5 on RCSB PDB site
Description:
Deposited on 1999-05-17, released 2000-05-17
The last revision prior to the SCOP 1.67 freeze date was dated 2000-05-17, with a file datestamp of 2000-05-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1qc5a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1qc5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qc5A (A:)
    stqldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnky
    ssteevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdn
    hrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeia
    lvtivktlgeri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qc5B (B:)
    stqldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnky
    ssteevlvaakkivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdn
    hrlkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeia
    lvtivktlgeri
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qc5B (B:)
    qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
    teevlvaakkivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnhr
    lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeialv
    tivktlgeri