PDB entry 1qbs

View 1qbs on RCSB PDB site
Description: hiv-1 protease inhibitors wiih low nanomolar potency
Class: aspartyl protease
Keywords: hydrolase (acid proteinase), aspartyl protease
Deposited on 1997-04-25, released 1997-10-15
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • modified residue (66)
    • conflict (94)
  Domains in SCOP 1.75: d1qbsa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04585 (0-98)
    • modified residue (66)
    • conflict (94)
  Domains in SCOP 1.75: d1qbsb_
• Heterogens: DMP

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qbsA (A:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigatlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1qbsB (B:)
  pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigatlnf