PDB entry 1qbq

View 1qbq on RCSB PDB site
Description: structure of rat farnesyl protein transferase complexed with a cvim peptide and alpha-hydroxyfarnesylphosphonic acid.
Class: transferase
Keywords: alpha-alpha-barrel helical crescent, transferase
Deposited on 1999-04-27, released 1999-06-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fpt alpha-subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qbqa_
  • Chain 'B':
    Compound: fpt beta-subunit
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qbqb_
  • Chain 'P':
    Compound: acetyl-cys-val-ile-selenomet-cooh peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1QBQ (Start-3)
  • Heterogens: ACT, ZN, HFP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qbqA (A:)
    eaaaspmddgflsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfr
    avlqrderserafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpk
    nyqvwhhrrvlvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvd
    qllkedvrnnsvwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgil
    qdrglsrypnllnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceil
    akekdtirkeywryigrslqskhsresdipasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbqA (A:)
    flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
    rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyitaiieeqpknyqvwhhrrv
    lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
    svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
    llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
    ywryigrslqsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qbqB (B:)
    massssftyycppssspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfs
    sykfnhlvprlvlqrekhfhylkrglrqltdayecldasrpwlcywilhslelldepipq
    ivatdvcqflelcqspdggfgggpgqyphlaptyaavnalciigteeaynvinrekllqy
    lyslkqpdgsflmhvggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggig
    gvpgmeahggytfcglaalvilkkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcy
    sfwqagllpllhralhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdf
    yhtcyclsglsiaqhfgsgamlhdvvmgvpenvlqpthpvynigpdkviqatthflqkpv
    pgfeecedavtsdpatd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbqB (B:)
    lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
    krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
    gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
    saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
    kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
    lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
    hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf
    

  • Chain 'P':
    No sequence available.