PDB entry 1qbm

View 1qbm on RCSB PDB site
Description:
Deposited on 1998-05-01, released 1999-01-27
The last revision prior to the SCOP 1.65 freeze date was dated 1999-01-27, with a file datestamp of 1999-01-27.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.194
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1qbmh1, d1qbmh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1qbml1, d1qbml2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbmH (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky
    dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgttltvssaet
    tppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbmL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec