PDB entry 1qbl

View 1qbl on RCSB PDB site
Description: fab e8 (fabe8a) x-ray structure at 2.26 angstrom resolution
Class: immunoglobulin
Keywords: immunoglobulin, igg1 kappa, antibody, fab fragment, anti-cytochrome c antibody
Deposited on 1998-04-29, released 1998-12-02
The last revision prior to the SCOP 1.73 freeze date was dated 1998-12-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fabe8a
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PIR S49220 (1-218)
      • conflict (2)
      • conflict (4-5)
      • conflict (13)
      • conflict (42)
      • conflict (54)
      • conflict (56-57)
      • conflict (65-66)
      • conflict (75)
      • conflict (96)
      • conflict (99-104)
      • conflict (118)
      • conflict (131)
      • conflict (134-136)
      • conflict (181)
      • conflict (194)
      • conflict (217)
    Domains in SCOP 1.73: d1qblh1, d1qblh2
  • Chain 'L':
    Compound: fabe8a
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qbll1, d1qbll2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qblH (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpekglewigridpasgntky
    dpkfqdkatitadtssntaylqlssltsedtavyycagydygnfdywgqgttltvssaet
    tppsvyplapgtaalkssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    ltssvtvpsstwpsqtvtcnvahpasstkvdkkivprnc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qblL (L:)
    diqmtqspaslsasvgetvtitcrasgnihnylawyqqkqgkspqllvynaktladgvps
    rfsgsgsgtqyslkinslqpedfgsyycqhfwstpwtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec