PDB entry 1qbk

View 1qbk on RCSB PDB site
Description: structure of the karyopherin beta2-ran gppnhp nuclear transport complex
Deposited on 1999-04-23, released 1999-06-01
The last revision prior to the SCOP 1.59 freeze date was dated 1999-06-01, with a file datestamp of 1999-05-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.267
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Domains in SCOP 1.59: d1qbkb_
  • Chain 'C':
    Domains in SCOP 1.59: d1qbkc_

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qbkB (B:)
    yewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksede
    ptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskge
    lqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdvldrplnimipkflqf
    fkhsspkirshavacvnqfiisrtqalmlhidsftenlfalagdeepevrknvcralvml
    levrmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklip
    vlvngmkysdidiillkgdveedetipdseqdirprfhrsrtvaqqhdedgieeeddddd
    eiddddtisdwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgilvlg
    aiaegcmqgmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplm
    tellkrildsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknllily
    daigtladsvghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgfl
    pycepvyqrcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieql
    varsniltlmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefi
    svcnnatwaigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrlgyvc
    pqevapmlqqfirpwctslrnirdneekdsafrgictmisvnpsgviqdfiffcdavasw
    inpkddlrdmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbkB (B:)
    yewkpdeqglqqilqllkesqspdttiqrtvqqkleqlnqypdfnnylifvltklksede
    ptrslsglilknnvkahfqnfpngvtdfikseclnnigdsspliratvgilittiaskge
    lqnwpdllpklcslldsedyntcegafgalqkicedsaeildsdrplnimipkflqffkh
    sspkirshavacvnqfiisrtqalmlhidsftenlfalagdeepevrknvcralvmllev
    rmdrllphmhniveymlqrtqdqdenvaleacefwltlaeqpickdvlvrhlpklipvlv
    ngmkysdidiillkgdveedetipdseqdirprfhrsrtvaqqhdeddddddeiddddti
    sdwnlrkcsaaaldvlanvyrdellphilpllkellfhhewvvkesgilvlgaiaegcmq
    gmipylpeliphliqclsdkkalvrsitcwtlsryahwvvsqppdtylkplmtellkril
    dsnkrvqeaacsafatleeeactelvpylayildtlvfafskyqhknllilydaigtlad
    svghhlnkpeyiqmlmppliqkwnmlkdedkdlfplleclssvatalqsgflpycepvyq
    rcvnlvqktlaqamlnnaqpdqyeapdkdfmivaldllsglaeglggnieqlvarsnilt
    lmyqcmqdkmpevrqssfallgdltkacfqhvkpciadfmpilgtnlnpefisvcnnatw
    aigeisiqmgiemqpyipmvlhqlveiinrpntpktllentaitigrlgyvcpqevapml
    qqfirpwctslrnirdneekdsafrgictmisvnpsgviqdfiffcdavaswinpkddlr
    dmfckilhgfknqvgdenwrrfsdqfplplkerlaafygv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbkC (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqy