PDB entry 1qbg

View 1qbg on RCSB PDB site
Description: crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
Class: oxidoreductase
Keywords: quinone, fad, oxidoreductase, dt-diaphorase
Deposited on 1999-04-20, released 2000-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.232
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-271)
      • conflict (0)
    Domains in SCOPe 2.06: d1qbga_
  • Chain 'B':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1qbgb_
  • Chain 'C':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-271)
      • conflict (0)
    Domains in SCOPe 2.06: d1qbgc_
  • Chain 'D':
    Compound: nad(p)h dehydrogenase [quinone] 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15559 (0-271)
      • conflict (0)
    Domains in SCOPe 2.06: d1qbgd_
  • Heterogens: FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbgA (A:)
    vrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
    panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
    gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
    qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
    vqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qbgB (B:)
    vrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
    panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
    gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
    qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
    vqdeeknkkfglsvghhlgksiptdnqikark
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbgB (B:)
    rralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkdp
    anfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfig
    efaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgfq
    vlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkkev
    qdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbgC (C:)
    vrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
    panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
    gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
    qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
    vqdeeknkkfglsvghhlgksiptdnqikark
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbgD (D:)
    vrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
    panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
    gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
    qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
    vqdeeknkkfglsvghhlgksiptdnqikark