PDB entry 1qbf

View 1qbf on RCSB PDB site
Description: nmr solution structure of porcine peptide yy
Deposited on 1999-04-16, released 2000-08-16
The last revision was dated 2019-11-13, with a file datestamp of 2019-11-08.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide YY
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOP 1.57, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1qbfA (A:)
ypakpeapgedaspeelsryyaslrhylnlvtrqry