PDB entry 1qbe

View 1qbe on RCSB PDB site
Description: bacteriophage q beta capsid
Class: Virus
Keywords: COAT PROTEIN, RNA BINDING, Icosahedral virus
Deposited on 1996-01-10, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.304
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacteriophage q beta capsid
    Species: Bacteriophage Q-beta
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qbea_
  • Chain 'B':
    Compound: bacteriophage q beta capsid
    Species: Bacteriophage Q-beta
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qbeb_
  • Chain 'C':
    Compound: bacteriophage q beta capsid
    Species: Bacteriophage Q-beta
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1qbec_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qbeA (A:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
    nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
    lidaidqlnpay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbeA (A:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpnykvq
    vkiqnptactcdpsvtrqayadvtfsftqystdeerafvrtelaallaspllidaidqln
    pay
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbeB (B:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
    nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
    lidaidqlnpay
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qbeC (C:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpsrnrk
    nykvqvkiqnptactangscdpsvtrqayadvtfsftqystdeerafvrtelaallaspl
    lidaidqlnpay
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qbeC (C:)
    akletvtlgnigkdgkqtlvlnprgvnptngvaslsqagavpalekrvtvsvsqpnykvq
    vkiqnptactcdpsvtrqayadvtfsftqystdeerafvrtelaallaspllidaidqln
    pay