PDB entry 1qbb

View 1qbb on RCSB PDB site
Description: bacterial chitobiase complexed with chitobiose (dinag)
Class: glycosyl hydrolase
Keywords: glycosyl hydrolase, chitobiase, chitinolysis, ba8-barrel
Deposited on 1996-06-07, released 1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.148
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitobiase
    Species: Serratia marcescens [TaxId:615]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54468 (0-857)
      • conflict (538)
      • conflict (800)
    Domains in SCOPe 2.06: d1qbba1, d1qbba2, d1qbba3, d1qbba4
  • Heterogens: CBS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qbbA (A:)
    dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
    yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
    prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfvsnadlqt
    lpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallgvpvqtng
    ypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvpsdgsgki
    atldasdaprfpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieip
    glpeltevggqrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipei
    dmpaharaavvsmearykklhaagkeqeanefrlvdptdtsnttsvqffnrqsylnpcld
    ssqrfvdkvigeiaqmhkeagqpiktwhfggdeaknirlgagytdkakpepgkgiidqgn
    edkpwaksqvcqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaessk
    afatsrvgvnfwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgt
    rfsderkvfsfapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqm
    eymifpralsvaerswhragweqdyragreykggethfvdtqalekdwlrfanilgqrel
    akldkggvayrlpvpgarvaggkleanialpglgieystdggkqwqrydakakpavsgev
    qvrsvspdgkrysraekv