PDB entry 1qba

View 1qba on RCSB PDB site
Description: bacterial chitobiase, glycosyl hydrolase family 20
Deposited on 1996-06-06, released 1997-01-11
The last revision prior to the SCOP 1.67 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.146
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1qba_ (-)
    dqqlvdqlsqlklnvkmldnragengvdcaalgadwascnrvlftlsndgqaidgkdwvi
    yfhsprqtlrvdndqfkiahltgdlykleptakfsgfpagkaveipvvaeywqlfrndfl
    prwyatsgdakpkmlantdtenldqfvapftgdqwkrtkddknilmtpasrfvsnadlqt
    lpagalrgkivptpmqvkvhaqdadlrkgvaldlstlvkpaadvvsqrfallgvpvqtng
    ypiktdiqpgkfkgamavsgayelkigkkeaqvigfdqagvfyglqsilslvpsdgsgki
    atldasdaprfpyrgifldvarnfhkkdavlrlldqmaayklnkfhfhlsddegwrieip
    glpeltevggqrchdlsettcllpqygqgpdvyggffsrqdyidiikyaqarqievipei
    dmpaharaavvsmearykklhaagkeqeanefrlvdptdtsnttsvqffnrqsylnpcld
    ssqrfvdkvigeiaqmhkeagqpiktwhfggdeaknirlgagytdkakpepgkgiidqgn
    edkpwaksqvcqtmikegkvadmehlpsyfgqevsklvkahgidrmqawqdglkdaessk
    afatsrvgvnfwdtlywggfdsvndwankgyevvvsnpdyvymdfpyevnpdergyywgt
    rfsderkvfsfapdnmpqnaetsvdrdgnhfnaksdkpwpgayglsaqlwsetqrtdpqm
    eymifpralsvaerswhragweqdyragreykggethfvdtqalekdwlrfanilgqrel
    akldkggvayrlpvpgarvaggkleanialpglgieystdggkqwqrydakakpavsgev
    qvrsvspdgkrysraekv